PDB entry 1nat

View 1nat on RCSB PDB site
Description: crystal structure of spoof from bacillus subtilis
Class: regulatory protein
Keywords: aspartate pocket, sporulation response regulator, two component system, regulatory protein
Deposited on 1997-09-09, released 1998-10-14
The last revision prior to the SCOP 1.75 freeze date was dated 1998-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sporulation response regulatory protein
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nata_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1natA (A:)
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn

    Sequence, based on observed residues (ATOM records): (download) 
    >1natA (A:)
nekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl