PDB entry 1nar

View 1nar on RCSB PDB site
Description: crystal structure of narbonin refined at 1.8 angstroms resolution
Class: plant seed protein
Keywords: plant seed protein
Deposited on 1993-09-10, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: narbonin
    Species: Vicia narbonensis
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08884 (0-End)
      • conflict (288)
    Domains in SCOP 1.75: d1nara_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1narA (A:)
    pkpifreyigvkpnsttlhdfpteiintetlefhyilgfaiesyyesgkgtgtfeeswdv
    elfgpekvknlkrrhpevkvvisiggrgvntpfdpaeenvwvsnakeslkliiqkysdds
    gnlidgidihyehirsdepfatlmgqlitelkkdddlninvvsiapsennsshyqklyna
    kkdyinwvdyqfsnqqkpvstddafveifkslekdyhphkvlpgfstdpldtkhnkitrd
    ifiggctrlvqtfslpgvffwnandsvipkrdgdkpfiveltlqqllaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1narA (A:)
    pkpifreyigvkpnsttlhdfpteiintetlefhyilgfaiesyyesgkgtgtfeeswdv
    elfgpekvknlkrrhpevkvvisiggrgvntpfdpaeenvwvsnakeslkliiqkysdds
    gnlidgidihyehirsdepfatlmgqlitelkkdddlninvvsiapsennsshyqklyna
    kkdyinwvdyqfsnqqkpvstddafveifkslekdyhphkvlpgfstdpldtkhnkitrd
    ifiggctrlvqtfslpgvffwnandsvipkrdgdkpfiveltlqqllaa