PDB entry 1nag

View 1nag on RCSB PDB site
Description: crevice-forming mutants in the rigid core of bovine pancreatic trypsin inhibitor: crystal structures of f22a, y23a, n43g, and f45a
Deposited on 1992-08-18, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.163
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1nag__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nag_ (-)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrgnfksaedcmrtcg