PDB entry 1n91

View 1n91 on RCSB PDB site
Description: Solution NMR Structure of Protein yggU from Escherichia coli. Northeast Structural Genomics Consortium Target ER14.
Class: Structural Genomics/Unknown function
Keywords: ALPHA+BETA; Northeast Structural Genomics Consortium, PSI, Protein Structure Initiative, NESG, Structural Genomics-Unknown function COMPLEX
Deposited on 2002-11-21, released 2003-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: orf, hypothetical protein
  Species: Escherichia coli [TaxId:155864]
  Gene: yggU
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8XCU6 (0-99)
    • expression tag (100-107)
  Domains in SCOPe 2.07: d1n91a1, d1n91a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n91A (A:)
  mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflg
  kqfrvaksqvviekgelgrhkqikiinpqqippevaalinlehhhhhh