PDB entry 1n8v

View 1n8v on RCSB PDB site
Description: chemosensory protein in complex with bromo-dodecanol
Deposited on 2002-11-21, released 2003-04-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-01, with a file datestamp of 2003-04-01.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.181
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1n8va_
  • Chain 'B':
    Domains in SCOP 1.65: d1n8vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8vA (A:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8vA (A:)
    kytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenq
    ekgayrviehlikneieiwreltakydptgnwrkkyedrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n8vB (B:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8vB (B:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrak