PDB entry 1n8u

View 1n8u on RCSB PDB site
Description: Chemosensory Protein in Complex with bromo-dodecanol
Deposited on 2002-11-21, released 2003-04-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1n8ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8uA (A:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8uA (A:)
    kytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenq
    ekgayrviehlikneieiwreltakydptgnwrkkyedra