PDB entry 1n8p

View 1n8p on RCSB PDB site
Description: Crystal Structure of cystathionine gamma-lyase from yeast
Deposited on 2002-11-21, released 2002-12-04
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.253
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1n8pa_
  • Chain 'B':
    Domains in SCOP 1.71: d1n8pb_
  • Chain 'C':
    Domains in SCOP 1.71: d1n8pc_
  • Chain 'D':
    Domains in SCOP 1.71: d1n8pd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8pA (A:)
    tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
    eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
    tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
    flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
    fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
    dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
    sgvfddlvrisvgiedtddlledikqalkqatn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8pB (B:)
    tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
    eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
    tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
    flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
    fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
    dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
    sgvfddlvrisvgiedtddlledikqalkqatn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8pC (C:)
    tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
    eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
    tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
    flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
    fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
    dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
    sgvfddlvrisvgiedtddlledikqalkqatn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8pD (D:)
    tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
    eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
    tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
    flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
    fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
    dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
    sgvfddlvrisvgiedtddlledikqalkqatn