PDB entry 1n8e

View 1n8e on RCSB PDB site
Description: Fragment Double-D from Human Fibrin
Deposited on 2002-11-20, released 2003-01-07
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8eA (A:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8eB (B:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8eC (C:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8eD (D:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8eE (E:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8eF (F:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnr