PDB entry 1n8e

View 1n8e on RCSB PDB site
Description: Fragment Double-D from Human Fibrin
Class: blood clotting
Keywords: Cross-linked fibrin, D:D interfaces; crystal packing, BLOOD CLOTTING
Deposited on 2002-11-20, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4.5 Å
R-factor: 0.415
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrin alpha/alpha-E chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8ea_
  • Chain 'B':
    Compound: Fibrin beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8eb1, d1n8eb2
  • Chain 'C':
    Compound: Fibrin gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8ec1, d1n8ec2
  • Chain 'D':
    Compound: Fibrin alpha/alpha-E chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8ed_
  • Chain 'E':
    Compound: Fibrin beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8ee1, d1n8ee2
  • Chain 'F':
    Compound: Fibrin gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8ef1, d1n8ef2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8eA (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsrdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8eA (A:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n8eB (B:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8eB (B:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n8eC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8eC (C:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n8eD (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsrdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8eD (D:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n8eE (E:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8eE (E:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n8eF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8eF (F:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnr