PDB entry 1n86

View 1n86 on RCSB PDB site
Description: Crystal structure of human D-dimer from cross-linked fibrin complexed with GPR and GHRPLDK peptide ligands.
Class: blood clotting
Keywords: cross-linked fibrin, protein-peptide complex, BLOOD CLOTTING
Deposited on 2002-11-19, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.226
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrin alpha/alpha-E chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n86a_
  • Chain 'B':
    Compound: Fibrin beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n86b1, d1n86b2
  • Chain 'C':
    Compound: Fibrin gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAF22036
    Domains in SCOPe 2.07: d1n86c1, d1n86c2
  • Chain 'D':
    Compound: Fibrin alpha/alpha-E chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n86d_
  • Chain 'E':
    Compound: Fibrin beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n86e1, d1n86e2
  • Chain 'F':
    Compound: Fibrin gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAF22036
    Domains in SCOPe 2.07: d1n86f1, d1n86f2
  • Chain 'G':
    Compound: fibrin alpha chain peptide ligand fragment Gly-Pro-Arg
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: fibrin alpha chain peptide ligand fragment Gly-Pro-Arg
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: fibrin beta chain peptide ligand fragment Gly-His-Arg-Pro-Leu-Asp-Lys
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: fibrin beta chain peptide ligand fragment Gly-His-Arg-Pro-Leu-Asp-Lys
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NDG, MAN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n86A (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n86A (A:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n86B (B:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n86B (B:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n86C (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n86C (C:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n86D (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n86D (D:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n86E (E:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n86E (E:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n86F (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggakqagdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n86F (F:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.