PDB entry 1n7s

View 1n7s on RCSB PDB site
Description: high resolution structure of a truncated neuronal snare complex
Deposited on 2002-11-16, released 2002-12-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.198
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1n7sa_
  • Chain 'B':
    Domains in SCOP 1.65: d1n7sb_
  • Chain 'C':
    Domains in SCOP 1.65: d1n7sc_
  • Chain 'D':
    Domains in SCOP 1.65: d1n7sd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sA (A:)
    gsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
    kyw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sB (B:)
    gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
    sdtkkavk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sC (C:)
    gsmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegm
    nhinqdmkeaeknlkdlgk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sD (D:)
    gsarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqr
    atkmlg