PDB entry 1n7m

View 1n7m on RCSB PDB site
Description: Germline 7G12 with N-methylmesoporphyrin
Deposited on 2002-11-15, released 2003-02-04
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7mH (H:)
    elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7mL (L:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepks