PDB entry 1n73

View 1n73 on RCSB PDB site
Description: Fibrin D-Dimer, Lamprey complexed with the PEPTIDE LIGAND: GLY-HIS-ARG-PRO-AMIDE
Class: blood clotting
Keywords: isopeptide cross-linked chains; protein-peptide complex, BLOOD CLOTTING
Deposited on 2002-11-12, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrin alpha-1 chain
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02674
      • see remark 999 (71)
    Domains in SCOPe 2.07: d1n73a_
  • Chain 'B':
    Compound: Fibrin beta chain
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n73b1, d1n73b2
  • Chain 'C':
    Compound: Fibrin gamma chain
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n73c1, d1n73c2
  • Chain 'D':
    Compound: Fibrin alpha-1 chain
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02674
      • see remark 999 (71)
    Domains in SCOPe 2.07: d1n73d_
  • Chain 'E':
    Compound: Fibrin beta chain
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n73e1, d1n73e2
  • Chain 'F':
    Compound: Fibrin gamma chain
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n73f1, d1n73f2
  • Chain 'G':
    Compound: peptide ligand: Gly-his-Arg-Pro-amide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N73 (0-3)
  • Chain 'H':
    Compound: peptide ligand: Gly-his-Arg-Pro-amide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N73 (0-3)
  • Chain 'I':
    Compound: peptide ligand: Gly-his-Arg-Pro-amide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N73 (0-3)
  • Chain 'J':
    Compound: peptide ligand: Gly-his-Arg-Pro-amide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N73 (0-3)
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n73A (A:)
    avsdtsgqtlnehnelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqil
    rvevdidvalrackgscaryleyrldkeknlqlekaasyianlkferfeevvveetlnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n73A (A:)
    evlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrackgscaryl
    eyrldkeknlqlekaasyianlkferfeevv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n73B (B:)
    ssthvnaqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsa
    pctvncrvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnr
    vdgssnfardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsd
    wegssvyaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfs
    tfdrdndnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvv
    wmnwkgswysmrqmamklrpkwp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n73B (B:)
    aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapctvnc
    rvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvdgssn
    fardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwegssv
    yaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstfdrdn
    dnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwmnwkg
    swysmrqmamklrpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n73C (C:)
    dsgqktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrsc
    qdttankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrh
    dgsvnftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthrya
    dyghfkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdnd
    kyegscaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslk
    mttmkllpmgrdlsghggqqqskgnsrgdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n73C (C:)
    ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrscqdtt
    ankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrhdgsv
    nftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthryadygh
    fkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdndkyeg
    scaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslkmttm
    kllpmgrdlsghggqqqskgns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n73D (D:)
    avsdtsgqtlnehnelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqil
    rvevdidvalrackgscaryleyrldkeknlqlekaasyianlkferfeevvveetlnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n73D (D:)
    ysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrackgscar
    yleyrldkeknlqlekaasyianlkferfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n73E (E:)
    ssthvnaqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsa
    pctvncrvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnr
    vdgssnfardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsd
    wegssvyaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfs
    tfdrdndnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvv
    wmnwkgswysmrqmamklrpkwp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n73E (E:)
    aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapctvnc
    rvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvdgssn
    fardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwegssv
    yaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstfdrdn
    dnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwmnwkg
    swysmrqmamklrpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n73F (F:)
    dsgqktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrsc
    qdttankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrh
    dgsvnftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthrya
    dyghfkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdnd
    kyegscaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslk
    mttmkllpmgrdlsghggqqqskgnsrgdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n73F (F:)
    ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrscqdtt
    ankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhrhdgsv
    nftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthryadygh
    fkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdndkyeg
    scaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwyslkmttm
    kllpmgrdlsghggqqqskgns
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.