PDB entry 1n72

View 1n72 on RCSB PDB site
Description: Structure and Ligand of a Histone Acetyltransferase Bromodomain
Class: transferase
Keywords: Histone acetyltransferase bromodomain, 4-helical bundle
Deposited on 2002-11-12, released 2002-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone acetyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PCAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92831 (4-117)
      • cloning artifact (3)
      • see remark 999 (89-90)
    Domains in SCOPe 2.04: d1n72a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n72A (A:)
    gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
    erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n72A (A:)
    mskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserl
    knryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk