PDB entry 1n70

View 1n70 on RCSB PDB site
Description: The Crystal Structure of Nitrite Reductase Mutant His287Ala from Rhodobacter Sphaeroides
Class: oxidoreductase
Keywords: Nitrite reductase, mutant H287A, electron transfer, nitrite oxide, OXIDOREDUCTASE
Deposited on 2002-11-12, released 2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase precursor
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239 (0-333)
      • conflict (189)
      • conflict (240)
      • engineered (246)
      • conflict (310)
      • conflict (326-327)
    Domains in SCOPe 2.06: d1n70a1, d1n70a2
  • Heterogens: CU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n70A (A:)
    lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
    gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
    gafvyhcapggpmipwhvvsgmagcimvlprdglkdhegkpvrydtvyyigesdhyipkd
    edgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhsqp
    nrdsrpaligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnhnl
    ieavhkgatahvlvegewdndlmeqvvapvgltg