PDB entry 1n6w

View 1n6w on RCSB PDB site
Description: Crystal Structure of Protein Tyrosine Phosphatase 1B with Potent and Selective Bidentate Inhibitor Compound 2
Class: hydrolase
Keywords: protein tyrosine phosphatase, ptp1b, phosphatase inhibitor
Deposited on 2002-11-12, released 2003-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-08-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: HOMO SAPIENS
    Gene: ptp1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6wa_
  • Heterogens: MG, SNA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6wA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6wA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed