PDB entry 1n6v

View 1n6v on RCSB PDB site
Description: Average structure of the interferon-binding ectodomain of the human type I interferon receptor
Class: immune system
Keywords: immunoglobulin fold, fibronectin fold, two-domain structure, IMMUNE SYSTEM
Deposited on 2002-11-12, released 2003-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interferon-alpha/beta receptor beta chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48551 (0-209)
    • cloning artifact (210-211)
  Domains in SCOPe 2.08: d1n6va1, d1n6va2, d1n6va3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n6vA (A:)
  sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
  ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfeppefeivgftnh
  invmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyiidklipntnyc
  vsvylehsdeqaviksplkctllppgqesefs