PDB entry 1n6q

View 1n6q on RCSB PDB site
Description: HIV-1 Reverse Transcriptase Crosslinked to pre-translocation AZTMP-terminated DNA (complex N)
Class: transferase/immune system/DNA
Keywords: drug resistance, HIV, nucleotide excision, reverse transcriptase, complex N, translocation, pre-translocation, TRANSFERASE/IMMUNE SYSTEM/DNA COMPLEX
Deposited on 2002-11-11, released 2003-01-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.247
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-557)
      • engineered (257)
      • engineered (279)
    Domains in SCOPe 2.01: d1n6qa1, d1n6qa2
  • Chain 'B':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-End)
      • engineered (279)
    Domains in SCOPe 2.01: d1n6qb_
  • Chain 'H':
    Compound: monoclonal antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6Q (0-224)
    Domains in SCOPe 2.01: d1n6qh1, d1n6qh2
  • Chain 'L':
    Compound: monoclonal antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6Q (0-210)
    Domains in SCOPe 2.01: d1n6ql1, d1n6ql2
  • Chain 'P':
    Compound: 5'-d(*a*cp*ap*gp*tp*cp*cp*cp*tp*gp*tp*tp*cp*gp*gp*(mrg)p*cp*gp*cp*cp*ap*(atm))-3'
    Species:
    Gene:
  • Chain 'T':
    Compound: 5'-d(*ap*t*gp*cp*ap*tp*gp*gp*cp*gp*cp*cp*cp*gp*ap*ap*cp*ap*gp*gp*gp*ap*cp*tp*gp*tp*g)-3'
    Species:
    Gene:
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6qA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n6qB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6qB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyql
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6qH (H:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6qL (L:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.