PDB entry 1n64

View 1n64 on RCSB PDB site
Description: Crystal structure analysis of the immunodominant antigenic site on Hepatitis C virus protein bound to mAb 19D9D6
Class: immune system
Keywords: antibody peptide complex, immune system
Deposited on 2002-11-08, released 2003-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 19D9D6 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N64 (0-217)
    Domains in SCOPe 2.08: d1n64h1, d1n64h2
  • Chain 'L':
    Compound: Fab 19D9D6 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N64 (0-219)
    Domains in SCOPe 2.08: d1n64l1, d1n64l2
  • Chain 'P':
    Compound: Genome polyprotein Capsid protein C
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n64H (H:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n64L (L:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.