PDB entry 1n59

View 1n59 on RCSB PDB site
Description: Crystal structure of the Murine class I Major Histocompatibility Complex of H-2KB, B2-Microglobulin, and A 9-Residue immunodominant peptide epitope gp33 derived from LCMV
Class: immune system
Keywords: Murine MHC, viral escape, LCMV, immunodominant epitope, IMMUNE SYSTEM
Deposited on 2002-11-05, released 2003-01-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1n59a1, d1n59a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1n59b_
  • Chain 'C':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1n59c1, d1n59c2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1n59d_
  • Chain 'P':
    Compound: nonameric peptide, gp33 derived from lymphocytic choriomeningitis virus
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QDK7 (Start-8)
      • engineered (8)
  • Chain 'Q':
    Compound: nonameric peptide, gp33 derived from lymphocytic choriomeningitis virus
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QDK7 (Start-8)
      • engineered (8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n59A (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n59B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n59C (C:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwep
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n59D (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.