PDB entry 1n51

View 1n51 on RCSB PDB site
Description: Aminopeptidase P in complex with the inhibitor apstatin
Class: hydrolase/hydrolase inhibitor
Keywords: aminopeptidase, proline specific, manganese enzyme, hydrolase-hydrolase inhibitor complex
Deposited on 2002-11-03, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xaa-pro aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: pepP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n51a1, d1n51a2
  • Chain 'B':
    Compound: apstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1N51 (0-End)
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n51A (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq
    

  • Chain 'B':
    No sequence available.