PDB entry 1n4y

View 1n4y on RCSB PDB site
Description: refined structure of kistrin
Class: Blood clotting
Keywords: beta, venom, blood coagulation, rgd
Deposited on 2002-11-02, released 2003-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-28, with a file datestamp of 2007-06-04.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kistrin
    Species: Agkistrodon rhodostoma
    Gene: RHOD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1n4ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n4yA (A:)
gkecdcsspenpccdaatcklrpgaqcgeglcceqckfsragkicriprgdmpddrctgq
sadcpryh