PDB entry 1n4x

View 1n4x on RCSB PDB site
Description:
Deposited on 2002-11-02, released 2003-06-10
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.227
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1n4xh_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1n4xi_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1n4xl_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1n4xm_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4xH (H:)
    evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvsa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n4xI (I:)
    evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4xI (I:)
    evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
    addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4xL (L:)
    mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4xM (M:)
    mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia