PDB entry 1n4g

View 1n4g on RCSB PDB site
Description: Structure of CYP121, a Mycobacterial P450, in Complex with Iodopyrazole
Class: oxidoreductase
Keywords: P450 fold, iodopyrazole complex, heme binding, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2002-10-31, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: CYP121 OR RV2276 OR MT2336 OR MTCY339.34C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4ga_
  • Heterogens: HEM, PYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n4gA (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4gA (A:)
    atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
    ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkaleqflrdtanslldnl
    itegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdr
    dieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfltt
    alisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkgel
    vlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieallk
    kmpgvdlavpidqlvwrtrfqrriperlpvlw