PDB entry 1n49

View 1n49 on RCSB PDB site
Description: Viability of a Drug-Resistant HIV-1 Protease Variant: Structural Insights for Better Anti-Viral Therapy
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, substrate recognition, inhibitor binding, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-10-30, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (81)
    Domains in SCOPe 2.07: d1n49a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (81)
    Domains in SCOPe 2.07: d1n49b_
  • Chain 'C':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (81)
    Domains in SCOPe 2.07: d1n49c_
  • Chain 'D':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
      • engineered (81)
    Domains in SCOPe 2.07: d1n49d_
  • Heterogens: RIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n49A (A:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n49B (B:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n49C (C:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n49D (D:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpaniigrnlltqigctlnf