PDB entry 1n1s

View 1n1s on RCSB PDB site
Description: Trypanosoma rangeli sialidase
Class: Hydrolase
Keywords: beta propeller, lectin-like fold
Deposited on 2002-10-20, released 2003-01-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.174
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (3-End)
      • cloning artifact (0-2)
      • see remark 999 (52)
      • see remark 999 (179)
      • see remark 999 (188)
      • see remark 999 (374)
      • see remark 999 (608)
    Domains in SCOP 1.73: d1n1sa1, d1n1sa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1sA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatppskggcgaavpt
    aglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryq
    fanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapaspt
    gswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgapt
    dsrvtvtnvvlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1sA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpagcgaavptaglvgf
    lshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrf
    tlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelh
    kkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsrvtv
    tnvvlynrrlnsseirtlflsqdmigtd