PDB entry 1n1l

View 1n1l on RCSB PDB site
Description: crystal structure of hcv ns3 protease domain:ns4a peptide complex with covalently bound inhibitor (gw472467x)
Deposited on 2002-10-18, released 2003-10-21
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.185
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1n1l.1
  • Chain 'B':
    Domains in SCOP 1.71: d1n1l.2
  • Chain 'C':
    Domains in SCOP 1.71: d1n1l.1
  • Chain 'D':
    Domains in SCOP 1.71: d1n1l.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1lA (A:)
    asmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcing
    vcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrh
    advipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfi
    pvenlettmrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1lA (A:)
    apitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgag
    trtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfipvenlettmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n1lB (B:)
    asmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcing
    vcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrh
    advipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfi
    pvenlettmrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1lB (B:)
    qvegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpa
    pqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpa
    ghavglfraavctrgvtkavdfipvenlettmr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n1lC (C:)
    kkgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1lC (C:)
    kgsvvivgrivlsgkpaiipk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n1lD (D:)
    kkgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1lD (D:)
    gsvvivgrivlsgkpa