PDB entry 1n1i

View 1n1i on RCSB PDB site
Description: The structure of MSP-1(19) from Plasmodium knowlesi
Deposited on 2002-10-17, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1iA (A:)
    ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaec
    tmddkkeveckctkegseplfegvfcssssg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1iB (B:)
    ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaec
    tmddkkeveckctkegseplfegvfcssssgph
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1iC (C:)
    sahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaect
    mddkkeveckctkegseplfegvfcssssgphh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1iD (D:)
    ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaec
    tmddkkeveckctkegseplfegvfcs