PDB entry 1n19

View 1n19 on RCSB PDB site
Description: Structure of the HSOD A4V mutant
Class: oxidoreductase
Keywords: Greek Key beta-barrel, oxidoreductase
Deposited on 2002-10-16, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (4)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.07: d1n19a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (4)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.07: d1n19b_
  • Heterogens: CU1, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n19A (A:)
    matkvvavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n19A (A:)
    atkvvavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n19B (B:)
    matkvvavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n19B (B:)
    atkvvavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq