PDB entry 1n18

View 1n18 on RCSB PDB site
Description: Thermostable mutant of Human Superoxide Dismutase, C6A, C111S
Class: oxidoreductase
Keywords: greek key beta barrel, oxidoreductase
Deposited on 2002-10-16, released 2002-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18b_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18c_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18d_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18e_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18f_
  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18g_
  • Chain 'H':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18h_
  • Chain 'I':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18i_
  • Chain 'J':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (111)
    Domains in SCOPe 2.06: d1n18j_
  • Heterogens: CU1, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n18A (A:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18A (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n18B (B:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18B (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n18C (C:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18C (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n18D (D:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18D (D:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n18E (E:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18E (E:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n18F (F:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18F (F:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n18G (G:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18G (G:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n18H (H:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18H (H:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n18I (I:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18I (I:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1n18J (J:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n18J (J:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq