PDB entry 1n18

View 1n18 on RCSB PDB site
Description: Thermostable mutant of Human Superoxide Dismutase, C6A, C111S
Deposited on 2002-10-16, released 2002-11-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: -1.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n18a_
  • Chain 'B':
    Domains in SCOP 1.63: d1n18b_
  • Chain 'C':
    Domains in SCOP 1.63: d1n18c_
  • Chain 'D':
    Domains in SCOP 1.63: d1n18d_
  • Chain 'E':
    Domains in SCOP 1.63: d1n18e_
  • Chain 'F':
    Domains in SCOP 1.63: d1n18f_
  • Chain 'G':
    Domains in SCOP 1.63: d1n18g_
  • Chain 'H':
    Domains in SCOP 1.63: d1n18h_
  • Chain 'I':
    Domains in SCOP 1.63: d1n18i_
  • Chain 'J':
    Domains in SCOP 1.63: d1n18j_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18A (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18B (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18C (C:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18D (D:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18E (E:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18F (F:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18G (G:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18H (H:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18I (I:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n18J (J:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq