PDB entry 1n0y

View 1n0y on RCSB PDB site
Description: Crystal Structure of Pb-bound Calmodulin
Class: metal binding protein
Keywords: calmodulin, lead, metal binding protein
Deposited on 2002-10-15, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Paramecium tetraurelia [TaxId:5888]
    Gene: CAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0ya_
  • Chain 'B':
    Compound: calmodulin
    Species: Paramecium tetraurelia [TaxId:5888]
    Gene: CAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0yb_
  • Heterogens: PB, CAC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0yA (A:)
    aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
    vdemireadidgdghinyeefvrmmvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0yA (A:)
    aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflslmarkmkeqdseeelie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0yB (B:)
    aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
    vdemireadidgdghinyeefvrmmvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0yB (B:)
    lslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevdemirea
    didgdghinyeefvrmmvs