PDB entry 1n0v

View 1n0v on RCSB PDB site
Description: Crystal structure of elongation factor 2
Class: translation
Keywords: G-protein cis-proline, TRANSLATION
Deposited on 2002-10-15, released 2002-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.232
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n0vC (C:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0vC (C:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakgitikstaisl
    ysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcv
    qtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevl
    gdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkw
    tnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegk
    allkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkad
    lmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlm
    mgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevkn
    andlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkis
    ppvvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkarar
    imaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpif
    geemrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpe
    qavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmv
    fdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n0vD (D:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0vD (D:)
    vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakgitikstaisl
    ysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcv
    qtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevl
    gdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkw
    tnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegk
    allkvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkad
    lmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlm
    mgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevkn
    andlpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkis
    ppvvayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkarar
    imaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpif
    geemrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpe
    qavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatggqafpqmv
    fdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl