PDB entry 1n0u

View 1n0u on RCSB PDB site
Description: Crystal structure of yeast elongation factor 2 in complex with sordarin
Class: translation
Keywords: G-protein, cis-proline, TRANSLATION
Deposited on 2002-10-15, released 2003-02-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.236
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0uA (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0uA (A:)
    aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
    msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
    tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
    qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
    dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
    kvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlml
    yvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgr
    fvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknand
    lpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkisppv
    vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
    ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
    mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqav
    ggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqafpqmvfdhwst
    lgsdpldptskageivlaarkrhgmkeevpgwqeyydkl