PDB entry 1n08

View 1n08 on RCSB PDB site
Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
Deposited on 2002-10-11, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.22
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n08a_
  • Chain 'B':
    Domains in SCOP 1.63: d1n08b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n08A (A:)
    rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy
    amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag
    ldkliedihtdirvalnsmdrpsyssykkdpffk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n08B (B:)
    krpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfg
    yamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnya
    gldkliedihtdirvalnsmdrpsyssykkdpffk