PDB entry 1n07

View 1n07 on RCSB PDB site
Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
Deposited on 2002-10-11, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n07a_
  • Chain 'B':
    Domains in SCOP 1.63: d1n07b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n07A (A:)
    rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy
    amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag
    ldkliedihtdirvalnsmdrpsyssykkdpffk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n07B (B:)
    krpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfg
    yamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnya
    gldkliedihtdirvalnsmdrpsyssykkdpffk