PDB entry 1n06

View 1n06 on RCSB PDB site
Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
Class: transferase
Keywords: kinase, phosphoryl transferases, flavin cofactors, metal binding
Deposited on 2002-10-11, released 2003-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative riboflavin kinase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC18.16.C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n06a_
  • Chain 'B':
    Compound: putative riboflavin kinase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC18.16.C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n06b_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n06A (A:)
    mtvnleekrpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryr
    dsgvyfgyamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyi
    rpelnyagldkliedihtdirvalnsmdrpsyssykkdpffkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n06A (A:)
    rpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgy
    amvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnyag
    ldkliedihtdirvalnsmdrpsyssykkdpffk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n06B (B:)
    mtvnleekrpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryr
    dsgvyfgyamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyi
    rpelnyagldkliedihtdirvalnsmdrpsyssykkdpffkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n06B (B:)
    krpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfg
    yamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnya
    gldkliedihtdirvalnsmdrpsyssykkdpffk