PDB entry 1n05

View 1n05 on RCSB PDB site
Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
Deposited on 2002-10-11, released 2003-02-25
The last revision prior to the SCOP 1.65 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1n05a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n05A (A:)
    mtvnleekrpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryr
    dsgvyfgyamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyi
    rpelnyagldkliedihtdirvalnsmdrpsyssykkdpffkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n05A (A:)
    peivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfgya
    mvqkrvfpmvmsvsaevhlierqgedfyeeimrvivlgyirpelnyagldkliedihtdi
    rvalnsmdrpsyssykkdpffk