PDB entry 1mzy

View 1mzy on RCSB PDB site
Description: Crystal Structure of Nitrite Reductase
Class: oxidoreductase
Keywords: Nitrite reductase, mutant M182T, gating mechanism, electron transfer, OXIDOREDUCTASE
Deposited on 2002-10-10, released 2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.185
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239 (Start-332)
      • conflict (191)
      • conflict (242)
      • conflict (312)
      • conflict (328-329)
    Domains in SCOPe 2.06: d1mzya1, d1mzya2
  • Heterogens: CU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzyA (A:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgmagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzyA (A:)
    lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
    gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
    gafvyhcapggpmipwhvvsgmagcimvlprdglkdhegkpvrydtvyyigesdhyipkd
    edgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhsqp
    nrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnhnl
    ieavhkgatahvlvegewdndlmeqvvapvg