PDB entry 1mze

View 1mze on RCSB PDB site
Description: Human Factor Inhibiting HIF (FIH1)
Class: oxidoreductase
Keywords: beta-jellyroll, OXIDOREDUCTASE
Deposited on 2002-10-07, released 2002-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor inhibiting hif1
    Species: Homo sapiens [TaxId:9606]
    Gene: FIH-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mzea_
  • Heterogens: FE2, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzeA (A:)
    gamaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelien
    eepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprs
    nreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrg
    wgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdr
    qsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwyk
    gaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzeA (A:)
    sgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvyp
    alkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvekl
    qdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligme
    gnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerf
    pnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpieyplkahq
    kvaimrniekmlgealgnpqevgpllntmikgryn