PDB entry 1mzb

View 1mzb on RCSB PDB site
Description: Ferric uptake regulator
Class: gene regulation
Keywords: ferric uptake regulator, iron, dtxr, GENE REGULATION
Deposited on 2002-10-07, released 2003-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mzba_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzbA (A:)
    gsmvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvl
    tqfeaaglvvrhnfdgghavfeladsghhdhmvcvdtgeviefmdaeiekrqkeivrerg
    felvdhnlvlyvrkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzbA (A:)
    mvenselrkaglkvtlprvkilqmldsaqrhmsaedvykalmeagedvglatvyrvltqf
    eaaglvvrhnfdgghavfeladsghhdhmvcvdtgeviefmdaeiekrqkeivrergfel
    vdhnlvlyvrkkk