PDB entry 1mz6

View 1mz6 on RCSB PDB site
Description: Trypanosoma rangeli sialidase in complex with the inhibitor DANA
Class: hydrolase, hydrolase inhibitor
Keywords: inibitor complex, trypanosomal sialidase, sialyltransferase
Deposited on 2002-10-05, released 2002-10-16
The last revision prior to the SCOP 1.73 freeze date was dated 2002-10-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (0-End)
      • conflict (176)
    Domains in SCOP 1.73: d1mz6a1, d1mz6a2
  • Heterogens: NAG, DAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mz6A (A:)
    lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvatadaryetsfd
    nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
    wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefvggv
    gaaivgsngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
    liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
    mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
    tndvyslvfvrfigelqlmksvvrtwkeednhlasictpvvpatppskggcgaavptagl
    vgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfan
    yrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgsw
    elhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsr
    vtvtnivlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mz6A (A:)
    lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvatadaryetsfd
    nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
    wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefvggv
    gaaivgsngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
    liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
    mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
    tndvyslvfvrfigelqlmksvvrtwkeednhlasictpvvpacgaavptaglvgflshs
    angsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrftlva
    tvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelhkkyh
    vvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggpgaptdsrvtvtnivlyn
    rrlnsseirtlflsqdmigt