PDB entry 1myt

View 1myt on RCSB PDB site
Description: crystal structure to 1.74 angstroms resolution of metmyoglobin from yellowfin tuna (thunnus albacares): an example of a myoglobin lacking the d helix
Deposited on 1991-05-06, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.74 Å
R-factor: 0.177
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1myt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1myt_ (-)
  adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
  atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
  qtalrnvmgiiiadleanykelgfsg