PDB entry 1myj

View 1myj on RCSB PDB site
Description: distal polarity in ligand binding to myoglobin: structural and functional characterization of a threonine68(e11) mutant
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1992-02-27, released 1994-01-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (67)
    Domains in SCOPe 2.01: d1myja_
  • Chain 'B':
    Compound: Myoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • conflict (67)
    Domains in SCOPe 2.01: d1myjb_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1myjA (A:)
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1myjB (B:)
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg