PDB entry 1my7

View 1my7 on RCSB PDB site
Description: nf-kappab p65 subunit dimerization domain homodimer n202r mutation
Deposited on 2002-10-03, released 2002-12-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.233
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1my7a_
  • Chain 'B':
    Domains in SCOP 1.63: d1my7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1my7A (A:)
    taelkicrvnrrsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
    vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1my7B (B:)
    taelkicrvnrrsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
    vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdt