PDB entry 1my5

View 1my5 on RCSB PDB site
Description: NF-kappaB p65 subunit dimerization domain homodimer
Deposited on 2002-10-03, released 2002-12-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1my5a_
  • Chain 'B':
    Domains in SCOP 1.63: d1my5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1my5A (A:)
    taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
    vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1my5B (B:)
    taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
    vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd