PDB entry 1mxo

View 1mxo on RCSB PDB site
Description: AmpC beta-lactamase in complex with an m.carboxyphenylglycylboronic acid bearing the cephalothin R1 side chain
Class: hydrolase
Keywords: AmpC, beta-lactamase, cephalosporinase, serine hydrolase
Deposited on 2002-10-02, released 2003-03-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-03-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.187
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mxoa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mxob_
  • Heterogens: PO4, SM2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mxoA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mxoB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq