PDB entry 1mxe

View 1mxe on RCSB PDB site
Description: Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
Class: metal binding protein
Keywords: Calmodulin-Pepide Complex, Calmodulin, CaMKI, XRAY, metal binding protein
Deposited on 2002-10-02, released 2002-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxea_
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mxeb_
  • Chain 'E':
    Compound: Target Sequence of rat Calmodulin-Dependent Protein Kinase I
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Target Sequence of rat Calmodulin-Dependent Protein Kinase I
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mxeA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxeA (A:)
    lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
    dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
    mireadidgdgqvnyeefvtmmts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mxeB (B:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mxeB (B:)
    lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
    dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
    mireadidgdgqvnyeefvtmmts
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.