PDB entry 1mwt

View 1mwt on RCSB PDB site
Description: Structure of penicillin G acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.45 A resolution.
Class: biosynthetic protein
Keywords: penicillin binding protein, beta-lactam, d, d-transpeptidase, d-carboxypeptidase, penicillin G, BIOSYNTHETIC PROTEIN
Deposited on 2002-10-01, released 2002-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.233
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 2a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mwta1, d1mwta2, d1mwta3
  • Chain 'B':
    Compound: penicillin-binding protein 2a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mwtb1, d1mwtb2, d1mwtb3
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mwtA (A:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwtA (A:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelgrqigwfisydkdnpnmmmainv
    kdvqdkgmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mwtB (B:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwtB (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihienlkse
    rgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwvqddt
    fvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseelkqkeyk
    gykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiqltida
    kvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedkkep
    llnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtryevvn
    gnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqildneill
    adsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiskeninlltdg
    mqqvvnkthkediyrsyanligksgtaelrqigwfisydkdnpnmmmainvkdvqdkgma
    synakisgkvydelyengnkkydide