PDB entry 1mws

View 1mws on RCSB PDB site
Description: Structure of nitrocefin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.00 A resolution.
Class: biosynthetic protein
Keywords: penicillin binding protein, beta-lactam, d, d-transpeptidase, d-carboxypeptidase, nitrocefin, BIOSYNTHETIC PROTEIN
Deposited on 2002-10-01, released 2002-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 2a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mwsa1, d1mwsa2, d1mwsa3
  • Chain 'B':
    Compound: penicillin-binding protein 2a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mwsb1, d1mwsb2, d1mwsb3
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mwsA (A:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwsA (A:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihien
    lksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwv
    qddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseelkq
    keykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiql
    tidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklted
    kkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtry
    evvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnk
    nldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiske
    ninlltdgmqqvvnkthkediyrsyanligksgtaelkqigwfisydkdnpnmmmainvk
    dvqdkgmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mwsB (B:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwsB (B:)
    dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
    kvkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihienlks
    ergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqnwvqdd
    tfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseelkqkey
    kgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdiqltid
    akvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedkke
    pllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtryevv
    ngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqildneil
    ladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiskeninlltd
    gmqqvvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmainvkdvqdk
    gmasynakisgkvydelyengnkkydide